4.67 Rating by ClearWebStats
apicalmw.com is 3 years 7 months 3 weeks old. This website has a #4,139,529 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, apicalmw.com is SAFE to browse.
Get Custom Widget

Traffic Report of Apicalmw

Daily Unique Visitors: 116
Daily Pageviews: 232

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 4,139,529
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View apicalmw.com site advisor rating Not Applicable

Where is apicalmw.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with apicalmw.com

Hosted Country:

apicalmw.com hosted country US apicalmw.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View apicalmw.com HTML resources

Homepage Links Analysis

Apical Computer Trainers

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 10
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: 14 H6 Headings: 2
Total IFRAMEs: Not Applicable Total Images: 22
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

apicalmw.com favicon - jenniferchemsales.com

View apicalmw.com Pagerank   apicalmw.com alexa rank Not Applicable   apicalmw.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

apicalmw.com favicon - shrivishwakarmasafetytraininginstitute.com

View apicalmw.com Pagerank   apicalmw.com alexa rank Not Applicable   apicalmw.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

apicalmw.com favicon - theshineenglishacademy.com

View apicalmw.com Pagerank   apicalmw.com alexa rank Not Applicable   apicalmw.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

apicalmw.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View apicalmw.com Pagerank   apicalmw.com alexa rank Not Applicable   apicalmw.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

apicalmw.com favicon - 247bestpillpharma.com

View apicalmw.com Pagerank   apicalmw.com alexa rank Not Applicable   apicalmw.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 13 Sep 2020 08:27:57 GMT
Server: Apache
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 8863
Content-Type: text/html; charset=UTF-8

Domain Information for apicalmw.com

Domain Registrar: Domainshype.com, LLC apicalmw.com registrar info
Registration Date: 2020-09-08 3 years 7 months 3 weeks ago
Last Modified: 2020-09-08 3 years 7 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net apicalmw.com name server information 162.241.148.33 apicalmw.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net apicalmw.com name server information 162.241.148.33 apicalmw.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
apicalmw.com A 14400 IP:162.241.148.33
apicalmw.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
apicalmw.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
apicalmw.com SOA 86400 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:shakesolutionsmw.gmail.com
Serial:2020090802
Refresh:86400
Retry:7200
Expire:3600000
apicalmw.com MX 14400 Target:mail.apicalmw.com
apicalmw.com TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Apicalmw

Cell Phone Repair, Cell Phone Parts-iPhone, Samsung

apicalmw.com favicon - brokemycell.com

We provide cell phone repair service. Get your Samsung cell phone and iPhone screens repair from experts. Buy iPhone parts and Samsung parts for your broken cell phone and send it in for phone repair

View apicalmw.com Pagerank   Alexa rank for apicalmw.com 4,139,545   website value of apicalmw.com $ 240.00

On Contract - Blog de diseño y tendencias en muebles y decoración

apicalmw.com favicon - oncontract.es

On Contract, blog de diseño y tendencia en muebles, interiorismo comercial, hostelería, contract... y tendencias: estilo industrial, vintage, mid century.

View apicalmw.com Pagerank   Alexa rank for apicalmw.com 4,139,558   website value of apicalmw.com $ 240.00

Used Cars | Rose City Motors | Kalamazoo, MI 49048

apicalmw.com favicon - rosecitymotorskalamazoo.com

269-345-5500 Rose City Motors in Kalamazoo, MI offers a wide variety of used Ford, Chevy, Honda, Toyota, GMC, Jeep, Buick, cars, trucks, SUVs and car financing. Let us help you get financed and into the car you really want!

View apicalmw.com Pagerank   Alexa rank for apicalmw.com 4,139,570   website value of apicalmw.com $ 240.00

Alexis Antonakis Consultancy

apicalmw.com favicon - antonakis.co.uk

For web design with that personal touch. Alexis Antonakis Consultancy

View apicalmw.com Pagerank   Alexa rank for apicalmw.com 4,139,583   website value of apicalmw.com $ 240.00

Rantings of a Sandmonkey

apicalmw.com favicon - sandmonkey.org

Egyptian jan25 revolutionary blogger, activist and protester writes about Egyptian drive for free republic. Twitter hero #jan25 @sandmonkey.

View apicalmw.com Pagerank   Alexa rank for apicalmw.com 4,139,587   website value of apicalmw.com $ 240.00

Full WHOIS Lookup for apicalmw.com

Domain Name: APICALMW.COM
Registry Domain ID: 2558523259_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.domainshype.com
Registrar URL: http://www.domainshype.com
Updated Date: 2020-09-08T18:17:45Z
Creation Date: 2020-09-08T18:16:06Z
Registry Expiry Date: 2021-09-08T18:16:06Z
Registrar: Domainshype.com, LLC
Registrar IANA ID: 1660
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-09-13T08:27:41Z